Loading...
Statistics
Advertisement

62768.com
www.62768.com/

62768.com

Advertisement
62768.com is hosted in United States / San Jose . 62768.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_323_1608221.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by 62768.com

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_323_1608221.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 62768.com

Missing HTTPS protocol.

    Meta - 62768.com

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 50.117.120.253
    • Latitude: 37.34
    • Longitude: -121.89
    • Country: United States
    • City: San Jose

    Rname

    • mail.skrimple.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Tue, 30 Aug 2016 09:23:05 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=5covvhrjge19pl3n41pc4bf3d4; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: 62768.com
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 50.117.120.253
    host: 62768.com
    1. class: IN
    2. ttl: 86400
    3. type: MX
    4. pri: 1
    5. target: mail.skrimple.com
    host: 62768.com
    1. class: IN
    2. ttl: 86400
    3. type: TXT
    4. txt: v=spf1 ip6:fd0d:d741:e183::/48 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.2768.com, www.6r2768.com, www.r2768.com, www.6t2768.com, www.t2768.com, www.6z2768.com, www.z2768.com, www.6y2768.com, www.y2768.com, www.642768.com, www.42768.com, www.6768.com, www.620768.com, www.60768.com, www.62q768.com, www.6q768.com, www.62w768.com, www.6w768.com, www.6268.com, www.627t68.com, www.62t68.com, www.627z68.com, www.62z68.com, www.627y68.com, www.62y68.com, www.627u68.com, www.62u68.com, www.627568.com, www.62568.com, www.6278.com, www.6276r8.com, www.627r8.com, www.6276t8.com, www.627t8.com, www.6276z8.com, www.627z8.com, www.6276y8.com, www.627y8.com, www.627648.com, www.62748.com, www.6276.com, www.62768y.com, www.6276y.com, www.62768u.com, www.6276u.com, www.62768i.com, www.6276i.com, www.627686.com, www.62766.com,

    Other websites we recently analyzed

    1. تااوکه - سایت خبری استان بوشهر
      تااوکه - سایت خبری استان بوشهر
      Iran, Islamic Republic of - 92.50.2.106
      Server software: Apache/2
      Technology: CSS, Html, Javascript, MooTools, Php
      Number of Javascript: 2
      Number of meta tags: 5
    2. Teleskope und Zubehör | Wolfgang Lille – Spezialist für SONNE – Verkauf und Beratung
      Berlin (Germany) - 81.169.145.66
      Server software: Apache/2.2.31 (Unix)
      Technology: CSS, Flexslider, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 8
      Number of meta tags: 3
    3. hrprofession.co
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    4. Easton Sports Group
      Houston (United States) - 192.185.138.32
      Server software: nginx/1.10.0
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, Wordpress
      Number of Javascript: 11
      Number of meta tags: 2
    5. meada.com
      Switzerland - 141.8.224.25
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    6. melonella.com
      Dublin (Ireland) - 46.137.111.230
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html
    7. Klettertreff.org
      Herzfond
      Austria - 84.116.32.65
      Server software: Apache
      Technology: Html
      Number of meta tags: 4
    8. kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    9. www.aarhusdesignbureau.dk
      Denmark - 77.66.85.131
      Server software: Apache-Coyote/1.1
      Technology: Html
      Number of meta tags: 1
    10. CNC-Bertschinger AG - Präzisionsmechanik
      Jules Bertschinger AG, Präzisionsmechanik, CNC-Bearbeitung, Werkzeug- und Formenbau
      Switzerland - 217.196.177.100
      Server software: nginx
      Technology: Html, Javascript, jQuery UI, Php, Xoops
      Number of Javascript: 9
      Number of meta tags: 8

    Check Other Websites